The GMP grade * 15 (Human IL15) produced by Cellregen is expressed in prokaryotic system, purified, sterilized and filtered, with a molecular weight of approximately 14.0 kDa.
GMP grade * 15 (Human IL15)

Interleukin-15 (IL-15)It is a T cell growth factor that was discovered by two independent laboratories in 1994 and has similar biological functions to IL-2. IL-15 is mainly produced by monocytes and macrophages. IL-15 mRNA is expressed in various tissues of the human body, such as the heart, lungs, kidneys, especially the placenta and muscles. The cell source and target cell distribution are wider than IL-2, so it may exert a similar effect to IL-2 in areas where IL-2 is not expressed.
The mechanism of action of IL-15:
IL-15R α is widely expressed in humans and mice. The main mechanism of the IL-15 signaling pathway is that IL-15 binds to the IL-15R α subunit on cells, and IL-15 stays on the cell surface, forming immune synapses with IL-2R/IL-15R β - γ c on nearby effector NK cells or T cells, activating the JAK1/JAK3 and STAT3/STAT5 pathways, Syk kinase and phospholipase C (PLC) γ, Lck kinase and Shc, leading to the activation of PI3K/Akt and Ras/Raf/MAPK signaling cascades. These pathways lead to subsequent expression of Bcl2, Myc, Fos/Jun, and NFkB activation.

Biological functions and applications of IL-15:
IL-15 and IL-2 have similar biological functions. IL-15 and IL-2 share the gamma c-receptor subunit, and both cytokines can induce the differentiation of T cells, B cells, and natural killer cells (NK cells) and promote their proliferation. At present, IL-15 is often used in combination with IL-2 for in vitro expansion and culture of T cells or NK cells.
It is worth noting that IL-2 can cause excessive differentiation of T cells, forming aging T cells with weaker killing ability, and can induce apoptosis of activated T cells. The advantage of IL-15 in immune cell therapy is that it does not cause activated T cell apoptosis. Another characteristic of IL-15 in * is the maintenance of memory T cells, which plays an important role in * anti-tumor activity. IL-15, as a multifunctional cytokine, plays an important role in immunity, tumorigenesis, allergic reactions, and autoimmune diseases.
Provided by SairuichengGMP grade * 15 (Human IL15)It is prepared, inspected, and packaged in a clean room that meets GMP standards. This product has the characteristics of high purity, high activity, and low endotoxin, and has been widely used in cell culture related research and industrial production fields, and has been recognized by a large number of customers. At the same time, Serrui Cheng has established a comprehensive quality management system, which has passed the dual certification of ISO9001 and ISO13485 quality systems, effectively ensuring the high quality and traceability of recombinant cytokine products.
Source:Human Source
Expressing Host:E. coli
Amino acid sequence:
MGNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTES
GCKECEELEEKNIKEFLQSFVHIVQMFINTSSSGLEHHHHHH
Buffer system:50mM Tris.Cl, 1mM EDTA,pH8.5
Quality inspection:
Purity:Purity>95% detected by SDS-PAGE electrophoresis;

Biological activity:The ED50 was determined to be less than 1 ng/ml in a dose-dependent proliferation assay using CTLL-2 cells;

Endotoxins:Less than 1 EU/μ g;
Stability:The sample is stable when stored at -20 ℃ for one year.
Product Catalog
Item Number |
Product Name |
Specifications |
Catalog price |
PIL151 |
*15(Human IL15) |
10 μg |
615 |
PIL152 |
*15(Human IL15) |
50 μg |
1725 |
PIL153 |
*15(Human IL15) |
250 μg |
4315 |
PIL154 |
*15(Human IL15) |
500 μg |
6475 |
Please consult for discounted prices
Company Profile
Serruicheng (Beijing) Life Science Technology Co., Ltd. was established in September 2018. Serruicheng has professional molecular biology platforms, prokaryotic fermentation platforms, mammalian cell culture platforms, protein purification and formulation platforms. Serrui Chengneng is capable of developing recombinant proteins, polyclonal antibodies, monoclonal antibodies, genetically engineered antibodies (including nanobodies, single chain antibodies, bispecific antibodies, etc.), and cell therapy products. Serrui Cheng has gathered a group of experts in molecular biology, immunology, cell biology, biotechnology, and other fields. The technical team members come from domestic and foreign research institutes and biotechnology enterprises, with strong research and development capabilities and product development experience.
At present, Serrui Cheng has developed dozens of high-quality recombinant cytokines, all of which have the characteristics of high purity, high activity, and low endotoxin. They have been widely used in cell culture related research and industrial production fields, and have been recognized by a large number of customers.
Serrui Cheng has a clean room that meets GMP standards, and the recombinant cytokine series products are prepared, inspected, and packaged under GMP conditions. At the same time, Serrui Cheng has established a comprehensive quality management system, which has passed the dual certification of ISO9001 and ISO13485 quality systems, effectively ensuring the high quality and traceability of recombinant cytokine products.
Laboratory construction:
